Transcript | Ll_transcript_195482 |
---|---|
CDS coordinates | 205-897 (+) |
Peptide sequence | MAYAGHTTIVIPKPLVPHVGVEVLDLGCLYKLYMGLLAVFCTNSINIHAGLNGLEVGQTVVIASAILIHNIMQIGASTDPEYKQAHAFSVYLTQPLLGTSLALLSYNWYPSSVFVGDTFTYFAGMTMAVIGILGHFSETLLIFFLPQVLNFLLSLPQLSGYIPCPRHRLPKFDPKTGLLTGTNDGTLVNLSLRILGRKSEKVLCIYLLGFQALACGVCFLLRYILAGWYK* |
ORF Type | complete |
Blastp | UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase from Dictyostelium with 52.92% of identity |
---|---|
Blastx | UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase from Dictyostelium with 47.57% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454417.1) |
Pfam | Glycosyl transferase family 4 (PF00953.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer