Protein coding transcript 180288

• Transcript: Ll_transcript_195490
• CDS coordinates: 82-801 (+)
• Peptide sequence: MASKPRKRLSSTQTSTIPSSSEKENNKNNNTQQHKPNNNNSSSDSPIAPPKWGLIFKLSLFSIPPYLYLLFYHYPIEQDIRRSVLINAVMSLAGFFLTVKLIPVASRYVLKRNLFGYDINKKGTPMGDVKVPESLGIVVGIVFLVVAILFQYFNFTEDSNWLVEYNAALACICFMMLLGFVDDVLDVPWRVKLLLPSIAALPLLMAYAGHTTIVIPKPLVPHIGVEVLDLGKHSIPLCK*
• ORF Type: complete

Annotations of Ll_transcript_195490

• Blastp: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase from Dictyostelium with 53.25% of identity
• Blastx: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase from Dictyostelium with 47.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426509.1)
• Pfam: Glycosyl transferase family 4 (PF00953.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;