Protein coding transcript 180291

• Transcript: Ll_transcript_197269
• CDS coordinates: 552-1430 (+)
• Peptide sequence: MLRMRNSNNTNGLSNLMMSNGSKAEPGSKEWEMRPGGMLVQSRTGDSDRNSVPPPPTIRVKVKYGSIYHELNINSQATFGELKKMLSGPTGLHHEDQKLFYKDKERDSKAFLDIVGVKDKSKIVLKEDPISKEKRYLEMRKNAKKEKAAKSISEISLEVDRLGGRVSAFESITSKGGKIAETDMLSLIELLMNQLLKLDGIIADGDLKLQRKIQVKRVQKYVETLDMLKVKNSMPSSNDGHGPIQPQQKHSNVQRLAPIQEQPKIHSNVHHSLIPIEETREQPSRDSTSGVVV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197269

• Blastp: BAG family molecular chaperone regulator 1 from Arabidopsis with 70.43% of identity
• Blastx: BAG family molecular chaperone regulator 1 from Arabidopsis with 70.43% of identity
• Eggnog: BCL-2-associated athanogene(ENOG4111WNH)
• Kegg: Link to kegg annotations (AT5G52060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413781.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;