Protein coding transcript 180295

• Transcript: Ll_transcript_197299
• CDS coordinates: 793-1446 (+)
• Peptide sequence: MIRMRNSNNTNGLSNMMMSNGSKGESGSKEWEMRPGGMLVQTRTADSDRNSVPPPPTIRVKVKYGSIYHELNINSQATFGELKKMLSGPTGLHHEDQKLFYKDKERDSKAFLDIVGVKDKSKIVLKEDPISKEKRYLEMRKNAKKEKAAKSISEISLEVDRLGGRVSAFESITSKGGKIAETDMLSLIELLMNQLLKLDGIIADGDLKLQRKIQVNM*
• ORF Type: complete

Annotations of Ll_transcript_197299

• Blastp: BAG family molecular chaperone regulator 1 from Arabidopsis with 73.37% of identity
• Blastx: BAG family molecular chaperone regulator 1 from Arabidopsis with 62.36% of identity
• Eggnog: BCL-2-associated athanogene(ENOG4111WNH)
• Kegg: Link to kegg annotations (AT5G52060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413781.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;