Transcript | Ll_transcript_356302 |
---|---|
CDS coordinates | 2217-2801 (+) |
Peptide sequence | MGFLRDPCAFLRVLQSVLNTTGYRFILFTAGYEPLESTVHMIAAEASIDHSMRNEDCVHLYDGRLFCFSGSIPYGWLFPKCAAVIHHGGSGTTAAALQAGTPQVVCPFMLDQFYWAERMYWLGVSPEPLRRNHLVPDKNDDTSIQEAAHVLSMAIHDALSSRVKARAAETAKRLSLEDGVSEAIKHLKEELGLN* |
ORF Type | complete |
Blastp | Sterol 3-beta-glucosyltransferase UGT80B1 from Arabidopsis with 41.6% of identity |
---|---|
Blastx | Sterol 3-beta-glucosyltransferase UGT80B1 from Arabidopsis with 33.33% of identity |
Eggnog | Transferase(COG1819) |
Kegg | Link to kegg annotations (AT1G43620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418459.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer