Protein coding transcript 18031

• Transcript: Ll_transcript_356302
• CDS coordinates: 2217-2801 (+)
• Peptide sequence: MGFLRDPCAFLRVLQSVLNTTGYRFILFTAGYEPLESTVHMIAAEASIDHSMRNEDCVHLYDGRLFCFSGSIPYGWLFPKCAAVIHHGGSGTTAAALQAGTPQVVCPFMLDQFYWAERMYWLGVSPEPLRRNHLVPDKNDDTSIQEAAHVLSMAIHDALSSRVKARAAETAKRLSLEDGVSEAIKHLKEELGLN*
• ORF Type: complete

Annotations of Ll_transcript_356302

• Blastp: Sterol 3-beta-glucosyltransferase UGT80B1 from Arabidopsis with 41.6% of identity
• Blastx: Sterol 3-beta-glucosyltransferase UGT80B1 from Arabidopsis with 33.33% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT1G43620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418459.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;