Transcript | Ll_transcript_197144 |
---|---|
CDS coordinates | 1398-1823 (+) |
Peptide sequence | MAENVEETRSLAMTPTWSVATVLTVFVAVSLLVERSIHRLSNWLRKTNRNPLFAALEKMKEELMLLGFISLLLTATSRMIANICIPSKYYNSAFAPCTRSEINEEMEDNGSQERKLLISSAYPHLLRRMLNGINRSSCKEA* |
ORF Type | complete |
Blastp | MLO-like protein 11 from Arabidopsis with 67.67% of identity |
---|---|
Blastx | MLO-like protein 11 from Arabidopsis with 66.57% of identity |
Eggnog | May be involved in modulation of pathogen defense and leaf cell death (By similarity)(ENOG410XR5S) |
Kegg | Link to kegg annotations (AT5G53760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443958.1) |
Pfam | Mlo family (PF03094.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer