Protein coding transcript 180347

• Transcript: Ll_transcript_197149
• CDS coordinates: 984-1538 (+)
• Peptide sequence: MQRQSTFVKFHTSNPLATNSALIWVTCFFRQFGHSVVRADYLTLRNGFITNHHLLKKYDFHSYMIRSMEEEFQRIVGVSGHLWGFVVAFMLFNIKGSNLYFWIAVIPISLVLLVGTKLQHVIATLALENAGITGFFSDAKLKPRDELFWFKKPELLLFLIHFILFQNAFELASFFWFWVLPYPF*
• ORF Type: complete

Annotations of Ll_transcript_197149

• Blastp: MLO-like protein 11 from Arabidopsis with 83.05% of identity
• Blastx: MLO-like protein 11 from Arabidopsis with 80.65% of identity
• Eggnog: May be involved in modulation of pathogen defense and leaf cell death (By similarity)(ENOG410XR5S)
• Kegg: Link to kegg annotations (AT5G53760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443958.1)
• Pfam: Mlo family (PF03094.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;