Protein coding transcript 180360

• Transcript: Ll_transcript_195735
• CDS coordinates: 273-629 (+)
• Peptide sequence: MAEVGFSSKREQSSESNIDDLELPLFDFNTITIATNNFSEHNKLGQGGFGVVYKGILMEGQEIAVKRLSKNSGQGIEEFKNEVKLLVKLQHRNLVRLLGCSIQIDEDIDGRPGNCCEEI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_195735

• Blastp: Receptor-like serine/threonine-protein kinase SD1-8 from Arabidopsis with 63.89% of identity
• Blastx: Receptor-like serine/threonine-protein kinase SD1-8 from Arabidopsis with 62.28% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G21380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445609.1)
• Pfam: Receptor serine/threonine kinase (PF12398.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;