Protein coding transcript 1804

• Transcript: Ll_transcript_294523
• CDS coordinates: 25-336 (+)
• Peptide sequence: MHAEGKVLFIGGGIANFTNVASTFKGVIRALREVAPLLIEHKVQIWVRRAGPNYQEGLKNIKAVSIELGLDMHVFGPEMHVSGIVPLALVPGKYHSGIKEFEG*
• ORF Type: complete

Annotations of Ll_transcript_294523

• Blastp: Probable ATP-citrate synthase subunit 2 from Schizosaccharomyces with 58.76% of identity
• Blastx: Probable ATP-citrate synthase subunit 2 from Schizosaccharomyces with 58.76% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC22A12.16)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015932503.1)
• Pfam: ATP citrate lyase citrate-binding (PF16114.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;