Protein coding transcript 180441

• Transcript: Ll_transcript_197191
• CDS coordinates: 3445-3804 (+)
• Peptide sequence: MVIAILTESDMNLSDDLLEAIVDKTIADADKDNDGKISKEDWKAFVSTNPSLLKNMTLPYLKDISSAFPSFLFKSEAEMRKYLSACIIVHKRNVIDKLQREIISWMKEEITFILKLRYQ*
• ORF Type: complete

Annotations of Ll_transcript_197191

• Blastp: Calcineurin B-like protein 10 from Arabidopsis with 67.95% of identity
• Blastx: Calcineurin B-like protein 10 from Arabidopsis with 72.45% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT4G33000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429909.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;