Transcript | Ll_transcript_197608 |
---|---|
CDS coordinates | 2-352 (+) |
Peptide sequence | VNKIRFKCEAKLRGGFYVDPEAKLSFIIHIYGEEGECEDAKIKLQDRSIMNHLSSGNIDESTRSYSSEVRFPFHFLVFSVRNGNLISRFIDLIITFYHYVMDSCAFLFQLLYKFAS* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L7-3 from Arabidopsis with 79.31% of identity |
---|---|
Blastx | 60S ribosomal protein L7-3 from Arabidopsis with 79.31% of identity |
Eggnog | ribosomal large subunit biogenesis(COG1841) |
Kegg | Link to kegg annotations (AT2G44120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420912.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer