Protein coding transcript 180465

• Transcript: Ll_transcript_197608
• CDS coordinates: 2-352 (+)
• Peptide sequence: VNKIRFKCEAKLRGGFYVDPEAKLSFIIHIYGEEGECEDAKIKLQDRSIMNHLSSGNIDESTRSYSSEVRFPFHFLVFSVRNGNLISRFIDLIITFYHYVMDSCAFLFQLLYKFAS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_197608

• Blastp: 60S ribosomal protein L7-3 from Arabidopsis with 79.31% of identity
• Blastx: 60S ribosomal protein L7-3 from Arabidopsis with 79.31% of identity
• Eggnog: ribosomal large subunit biogenesis(COG1841)
• Kegg: Link to kegg annotations (AT2G44120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420912.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;