Protein coding transcript 180468

• Transcript: Ll_transcript_197602
• CDS coordinates: 47-415 (+)
• Peptide sequence: MGEAKGITVPESVLKKQKREQEWALAKTKEAEADKKKRVLNRKLIFNRAKQYAKEYSEQEKELIRLKREAKLRGGFYVDPEAKLLFIIRIRGYVSVLLQFIIYSNSSSHHYNYNYNVIVFQY*
• ORF Type: complete

Annotations of Ll_transcript_197602

• Blastp: 60S ribosomal protein L7-4 from Arabidopsis with 73.2% of identity
• Blastx: 60S ribosomal protein L7 from Gallus with 72.86% of identity
• Eggnog: ribosomal large subunit biogenesis(COG1841)
• Kegg: Link to kegg annotations (AT3G13580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448429.1)
• Pfam: Ribosomal L30 N-terminal domain (PF08079.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;