Protein coding transcript 1805

• Transcript: Ll_transcript_294587
• CDS coordinates: 2-481 (+)
• Peptide sequence: LKKTGVECTPPLTNARMLDTLVGEFIEEKCINPTFITGHPEMMSPLAKYHREHPGLCERFEAFVCKKEIVNAYTELNDPFDQRLRFEEQAAQKAQGDDEAQVMDEAFLTAMEYGLPPTGGWGMGIDRMVMFLTDNYSIKEALTFPFMKDDNNAPKPKAAE
• ORF Type: internal

Annotations of Ll_transcript_294587

• Blastp: Lysine--tRNA ligase cla4 from Cladosporium with 75.52% of identity
• Blastx: Lysine--tRNA ligase cla4 from Cladosporium with 76.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020230943.1)
• Pfam: tRNA synthetases class II (D, K and N) (PF00152.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;