Protein coding transcript 180566

• Transcript: Ll_transcript_197575
• CDS coordinates: 143-643 (+)
• Peptide sequence: MQFFLFIRSLSFVNIYYLLLGRIPVRLYVWTVSEDFDDLEDAPEIDNWDKVSYINRPIEIHKDDGKYFSLNDAVRSLLPEFFPGSSFVNEEDASINQSTGEEEENTFDPVSSFQPLENAEIKLVRIQGIEPKLEIPFSWVVNNLMNPEYFLHICVCLKLSGAKALQ*
• ORF Type: complete

Annotations of Ll_transcript_197575

• Blastp: Autophagy protein 5 from Arabidopsis with 55.8% of identity
• Blastx: Autophagy protein 5 from Arabidopsis with 55.8% of identity
• Eggnog: autophagy protein(ENOG410XQ71)
• Kegg: Link to kegg annotations (AT5G17290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456329.1)
• Pfam: Autophagy protein Apg5 (PF04106.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;