Protein coding transcript 180580

• Transcript: Ll_transcript_197731
• CDS coordinates: 188-1009 (+)
• Peptide sequence: MIQNGCIVSQGFAPVNSRPCKRFMPCSSVFGSTSLMSAKVALSNTRSSLQYNLESKSRPSTGMTFSNMSAPSSLLSRGGQNLLFRTIPMLPKRQKSCMTPQASKDVPTSFRYPPMTKKPRWYWRSLACLPYLMPLHETWMYAETAYNLHPFLEYFEFWTYPFLEAIGRLPSWFLMAYFFVAYLGIVRRKEWPHFFRFHVVMGMLLEIALQVIGTVSRWMPLSLYWGKLGMHFWTAVSFAYLFTVLESIRCALVGMYADIPFICDAAYIQIPYD*
• ORF Type: complete

Annotations of Ll_transcript_197731

• Blastp: Protein TIC 20-I, chloroplastic from Arabidopsis with 70.26% of identity
• Blastx: Protein TIC 20-I, chloroplastic from Arabidopsis with 70.26% of identity
• Eggnog: Tic20-like protein(ENOG4111GFU)
• Kegg: Link to kegg annotations (AT1G04940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455449.1)
• Pfam: Chloroplast import apparatus Tic20-like (PF16166.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;