Transcript | Ll_transcript_294532 |
---|---|
CDS coordinates | 3-614 (+) |
Peptide sequence | HLQGACNNKSWEERAFAEDAERILGGCIWPPRSYSCNFCKRDFRSAQALGGHMNIHRRDRARLKQNHSPHHNNESTLQFHHHHKNYCKSLYNSQFSDSSASEAKVQVNNVRKENFKGFGCNDYVETSLSVGLNNSVFEQKSAPTGSCDEEGISYKRPKTCISSIPIFRKPCSEFVLGLETGLEDLDLELRLGEPQIVEYRSRQ* |
ORF Type | 5prime_partial |
Blastp | Probable transcriptional regulator RABBIT EARS from Arabidopsis with 41.5% of identity |
---|---|
Blastx | Probable transcriptional regulator RABBIT EARS from Arabidopsis with 41.67% of identity |
Eggnog | transcriptional regulator RABBIT EARS(ENOG410YQ0K) |
Kegg | Link to kegg annotations (AT5G06070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418740.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer