Transcript | Ll_transcript_196806 |
---|---|
CDS coordinates | 95-937 (+) |
Peptide sequence | MRFSEEAEVIRPGAGVGVGIRKKGVTGVRAWLLLDSTGDTHVIQAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITANEVLLLNSRDPSVIPFVDELHSRIVRHHSHASKTPNHDSKDDQEDGMKILPFEFVALEACLEAACGVLDNEAKTLEQEAHPALDKLTSKISTLNLERVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMSLTDKLFQHHLEETSSTSPSINDDENDRHVKSFYHAYLFCNMYIIFPFCIFFAF* |
ORF Type | complete |
Blastp | Magnesium transporter MRS2-3 from Arabidopsis with 63% of identity |
---|---|
Blastx | Magnesium transporter MRS2-3 from Arabidopsis with 63% of identity |
Eggnog | Magnesium transporter(ENOG410XNNZ) |
Kegg | Link to kegg annotations (AT3G19640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425417.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer