Protein coding transcript 180611

• Transcript: Ll_transcript_196809
• CDS coordinates: 95-646 (+)
• Peptide sequence: MRFSEEAEVIRPGAGVGVGIRKKGVTGVRAWLLLDSTGDTHVIQAGKHAIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITANEVLLLNSRDPSVIPFVDELHSRIVRHHSHASKTPNHDSKDDQEDGMKILPFEFVALEACLEAACGVLDNEVSFFFSPFLFIFLSDFKN*
• ORF Type: complete

Annotations of Ll_transcript_196809

• Blastp: Magnesium transporter MRS2-3 from Arabidopsis with 57.56% of identity
• Blastx: Magnesium transporter MRS2-3 from Arabidopsis with 66.47% of identity
• Eggnog: Magnesium transporter(ENOG410XNNZ)
• Kegg: Link to kegg annotations (AT3G19640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425417.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;