Protein coding transcript 18062

• Transcript: Ll_transcript_392800
• CDS coordinates: 293-781 (+)
• Peptide sequence: MPEIQLGNHTIRSHGVSVARIHMHDWLILLLLVIIDAVLNIIEPFHRYVGEGMMTDLSYPLKDNTIPFWGVPIIAILLPLVIILVYYFIRNDVYDFHHAILGLLYSVLITAVITDAIKDGVGRPRPDFFWRCFPDGKAVRFEFYQLPRLSYQYHYAQYILLI*
• ORF Type: complete

Annotations of Ll_transcript_392800

• Blastp: Lipid phosphate phosphatase 2 from Arabidopsis with 80.88% of identity
• Blastx: Lipid phosphate phosphatase 2 from Arabidopsis with 79.14% of identity
• Eggnog: PHOsphatase(COG0671)
• Kegg: Link to kegg annotations (AT1G15080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435239.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;