Protein coding transcript 180634

• Transcript: Ll_transcript_196003
• CDS coordinates: 451-1182 (+)
• Peptide sequence: MQGAVEFKTEIELLSRVHHKNLVSLVGFCFEKDEQMLVYEYIPNGTLMDSLSGKSGIWMDWIRRLKVTLGAAKGLSYLHELANPPIIHRDIKSGNILLDSHLNAKVADFGLSKLLLDSDRGHVTTQVKGTMGYLDPEYYMTTQLTEKSDVYSFGVLMLELVTARRPIEQGKFIVREVNRIMDTSKDLYNLHSILDPTIIKETKPKGLEKFVELALRCVKEHAHDRPSMADVVKEVEHIIELVGL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_196003

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 67.35% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 64.63% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G49770)
• CantataDB: Link to cantataDB annotations (CNT0000210)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420064.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;