Transcript | Ll_transcript_196003 |
---|---|
CDS coordinates | 451-1182 (+) |
Peptide sequence | MQGAVEFKTEIELLSRVHHKNLVSLVGFCFEKDEQMLVYEYIPNGTLMDSLSGKSGIWMDWIRRLKVTLGAAKGLSYLHELANPPIIHRDIKSGNILLDSHLNAKVADFGLSKLLLDSDRGHVTTQVKGTMGYLDPEYYMTTQLTEKSDVYSFGVLMLELVTARRPIEQGKFIVREVNRIMDTSKDLYNLHSILDPTIIKETKPKGLEKFVELALRCVKEHAHDRPSMADVVKEVEHIIELVGL |
ORF Type | 3prime_partial |
Blastp | Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 67.35% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 64.63% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G49770) |
CantataDB | Link to cantataDB annotations (CNT0000210) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420064.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer