Protein coding transcript 180636

• Transcript: Ll_transcript_195994
• CDS coordinates: 3-1463 (+)
• Peptide sequence: CLENGVSQQSYCQVPKVIPSYSTPPNNCSPQKCTNSQISSPNCKCAYPYTGSLISRALSISNFNTSDYKDIEKSLMDSFRAQNLPVDSVSLSDPMKNSSNDNFQFTLSIFPSQTDRFNRTGVSQIAFVLSNQIYKSPEFFFPYLFIGANYRYYEGEPKNSSSGHTGIIVGAALAVFAFLVLAVLAGMYAISQKRRAQRMKEQNPFVNWEQNKDNGIAPQLKGARWFSFDELRRYSNNFAEANTIGTGGYGQVYQGVLPTGELVAIKRAAKQSMQGAAEFKTEIELLSRVHHKNLVSLVGFCFEKGEQMLVYEYIPNGTLMDSLTGKSGIWMDWIRRLKVTLGSAKGLTYLHELANPPIIHRDIKSGNILLDSHLNAKVADFGLSKLVDSDRDHVTTQVKGTMGYLDPEYYMTQLLTEKSDVYSFGVLMLELVTGRRPIQQGKYIVREVMKLIDTSKDLYNLHSILDPTIIKSTKPKGIEKFVELALR
• ORF Type: internal

Annotations of Ll_transcript_195994

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 52.55% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 52.55% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G49770)
• CantataDB: Link to cantataDB annotations (CNT0000210)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426452.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;