Protein coding transcript 180639

• Transcript: Ll_transcript_195997
• CDS coordinates: 2-1045 (+)
• Peptide sequence: FHMGDNKLSGQIPSKLFNSSMILVHVLFYGNQLVGTIPSSLSLVSTVEVVRFDKNGLTGGVPSNFNKLGQLSELYLSDNNFNGSLPDLSGMNSLTYVDMSNNSFTSSDYIPSWVTSLEVLTTVILEDNQLGGTFNISNGYSTSLQLINLQNNAITDYKPGNQKINFEVILSGNPFCLENGVSQQSYCQVVTAIPSYSTPANNCSAQTCSNSQISSPNCKCAYPYTGSLISRALSISIFNTTDYQDIEKSLLASFRAQNLPVDSVSLSNPTKNSSNDNFQFTLSVFPYQIDRFNRSGVSQIAFVLSNQIYKAPEFFSPYFFIGDDYGYYGGDSMSHHELEMIKSKPSI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_195997

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 38.14% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 38.33% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G49770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420064.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;