Protein coding transcript 180680

• Transcript: Ll_transcript_195562
• CDS coordinates: 69-1043 (+)
• Peptide sequence: MATPPDPLATSTTATAADAGETLSKNALKRELKNKQREEERKRKEEEKAKKAAEVQQAKDNNKSATAADEEDMDPTQYHENRLKSLAAQKAEGNNPYPHKFFVSLSIEEYIKKYGGLNNGEHLEDVSVSLSGRIMHKRASGAKLVFYDLHGGGFKVQVMADASKSDLDQAEFSKFHSNVKRGDIVGITGFPGKSKKGELSIFPKTFVLLSHCLHMMPRQKSAAAADNANLLKNPWVPGSTRNPETYILKDQETRYRLRHLDLMLNPEVREIFKTRSKVISYIRRFLDDLDFLEVGSLSVYSDACCLWFLSIHSPVFRHFQVETPM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_195562

• Blastp: Lysine--tRNA ligase, cytoplasmic from Arabidopsis with 66.08% of identity
• Blastx: Lysine--tRNA ligase, cytoplasmic from Arabidopsis with 66.95% of identity
• Eggnog: lysyl-trna synthetase(COG1190)
• Kegg: Link to kegg annotations (AT3G11710)
• CantataDB: Link to cantataDB annotations (CNT0001053)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439359.1)
• Pfam: OB-fold nucleic acid binding domain (PF01336.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;