Protein coding transcript 180689

• Transcript: Ll_transcript_196449
• CDS coordinates: 176-2224 (+)
• Peptide sequence: MEDSDGVLNFDFEGTLDAAPLPSITATVSAPSGPLIHHDASSVASSIPNANSLAITPHSASDHASANVQGRRSFRQTVCRHWLRSLCMKGDACGFLHQYDKARMPVCRFFRLYGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHAKFPGPPPPVEEILQKIQHLYSYNYNGPNKTFQQRGASYNQQVERSQFPQGVNSTNQGVAAKPLVAEPGNAQQQQQVQQSQQQVNQSQMQSPANGQPNQANRTAIPLPQGISRYFIVKSCNRENLELSVQQGVWATQRSNESKLNEAFDSVENVILIFSVNRTRHFQGCAKMTSRIGGSVSGGNWKYAHGTAHYGRNFSVKWLKLCELSFHKTRHLRNPYNENLPVKISRDCQELEPSIGEQLASLLYLEPDSELMAMSIAAESKREEERAKGVNPDNGGENPDIVPFEDNEEEEEEESDEEEESFGHGVGPPIQGRGRGRGMMWPPHMPLGRGVRPMPGMPGFNPGMMGDGLPYGPDGFGMPDLFGMGPRAFAPFGPRFSGDFGGPPAAMMFRGRPTQPGMFPGGGFGMMMNPGRPPFMGGMGIGGGNPPRGGRPVNMPPMFPPPPPPPQNANRVPKRDQRTNDRNDRHGSGSEQGRSQDMQSQSGGPDDDMQYQQGYKANQNDQNEDSESEDEAPRRSRHGEGKKKRDA*
• ORF Type: complete

Annotations of Ll_transcript_196449

• Blastp: 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 63.99% of identity
• Blastx: 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 70.81% of identity
• Eggnog: zinc finger(COG5084)
• Kegg: Link to kegg annotations (AT1G30460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440105.1)
• Pfam: YT521-B-like domain (PF04146.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;