| Transcript | Ll_transcript_196460 |
|---|---|
| CDS coordinates | 489-875 (+) |
| Peptide sequence | MQAISIAAETKREEEKAKGVNPDNAGENPDIVPFEDNEEEEEEESDEEEESFIQGAGPPNQGRGRGRGMMWPPHMPLGRGARPMPGMPGFNPGMMGDGLPYGPDGFGMPDLFGMGPRAFAPYGPRFSGD |
| ORF Type | 3prime_partial |
| Blastp | 30-kDa cleavage and polyadenylation specificity factor 30 from Arabidopsis with 71.97% of identity |
|---|---|
| Blastx | - |
| Eggnog | zinc finger(COG5084) |
| Kegg | Link to kegg annotations (AT1G30460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_012569987.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer