Protein coding transcript 180698

• Transcript: Ll_transcript_196459
• CDS coordinates: 86-520 (+)
• Peptide sequence: MCRYKLGFCPNGPDCRYRHAKFPGPPPPVEEILQKIQHLYSYNYNGPNKTFQQRGASYNQQVERSQFPQGVNSTNQGVAAKPLVAEPGNAQQQQQVQQSQQQVNQSQMQSPANGQPNQANRTAIPLPQGISRSVQSLVVFNRAR*
• ORF Type: complete

Annotations of Ll_transcript_196459

• Blastp: Zinc finger CCCH domain-containing protein 45 from Oryza sativa with 46.58% of identity
• Blastx: Zinc finger CCCH domain-containing protein 45 from Oryza sativa with 48.63% of identity
• Eggnog: zinc finger(COG5084)
• Kegg: Link to kegg annotations (4341840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419266.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;