Protein coding transcript 1807

• Transcript: Ll_transcript_294503
• CDS coordinates: 65-772 (+)
• Peptide sequence: MFPLQRGKELVIKFSNIPHQQQHQISGDLILDDYDSLGINDSDKIITSNQPKKLIYGAEKSTHDDSNEHMKKIVHRDIERQRRQEMATLHASLRSLLPLEFIKGKRSISDHMNEAVNYIKYMQENIKELGAKRDELKKLSNSKLENHETNHSSRTFTIHENNGIVRIEVTIGFIEEKHTLSKLLHLLVEEGLEVVNCLSTEINGRLLHSVHCEVNKSNSVDLSELKWKVANVITS*
• ORF Type: complete

Annotations of Ll_transcript_294503

• Blastp: Transcription factor bHLH118 from Arabidopsis with 45% of identity
• Blastx: Transcription factor bHLH118 from Arabidopsis with 41.25% of identity
• Eggnog: Transcription factor(ENOG41114KF)
• Kegg: Link to kegg annotations (AT4G25400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465265.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;