Protein coding transcript 180742

• Transcript: Ll_transcript_197336
• CDS coordinates: 35-691 (+)
• Peptide sequence: MAAFPYQYHPFFVDSSAFFLNNINISPPSQFNFHHQSSLDVTNQNTSCVEQSSKITISDNEPSVAKYISPQSSMVVDKLENDEQVTQKVTPMVKKRRIRCVSSLSNSQSKDVTEGEIKRQKKSNNGGVKREKKKDQKKSCEEPPKGYIHVRARRGEATDSHSLAERVRREKISERMKMLQLLVPGCDKVKLHFFVSLCFLFLFWLEHLYVYFFLALLK*
• ORF Type: complete

Annotations of Ll_transcript_197336

• Blastp: Transcription factor bHLH137 from Arabidopsis with 53.78% of identity
• Blastx: Transcription factor bHLH137 from Arabidopsis with 67.95% of identity
• Eggnog: Transcription factor(ENOG410YIH7)
• Kegg: Link to kegg annotations (AT5G50915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437197.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;