Protein coding transcript 180743

• Transcript: Ll_transcript_197313
• CDS coordinates: 35-994 (+)
• Peptide sequence: MAAFPYQYHPFFVDSSAFFLNNINISPPSQFNFHHQSSLDVTNQNTSCVEQSSKITISDNEPSVAKYISPQSSMVVDKLENDEQVTQKVTPMVKKRRIRCVSSLSNSQSKDVTEGEIKRQKKSNNGGVKREKKKDQKKSCEEPPKGYIHVRARRGEATDSHSLAERVRREKISERMKMLQLLVPGCDKVTGKALMLDEIINYVQSLQNQVEFLSLKLASANPMLYDLATDLDTLLVVTPEKLNSLASPSSLLNVQQCNSTNQVTALDKTILPTPNNDYVFNGSASVFLQGQRPNVFSEETDSHFWNTEDQPQKFHNPYG*
• ORF Type: complete

Annotations of Ll_transcript_197313

• Blastp: Transcription factor bHLH137 from Arabidopsis with 57.41% of identity
• Blastx: Transcription factor bHLH137 from Arabidopsis with 71.43% of identity
• Eggnog: Transcription factor(ENOG410YIH7)
• Kegg: Link to kegg annotations (AT5G50915)
• CantataDB: Link to cantataDB annotations (CNT0000674)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437190.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;