Transcript | Ll_transcript_197310 |
---|---|
CDS coordinates | 158-937 (+) |
Peptide sequence | MAAFSYQYHPFLLDPSFIPNTPIIMSSFTHTQQSHINTALHPSYEFHIPQPNQEINCVEQSSKVSICDTEPCSITKSNHSPQSSMVVDKLENGEHVTQKVSNMEKKRRNRNGSLLSGSTSKDSGEGRRKKQKKSNDEVKEEEKRKEEKKVDKEVPEQPPKGYIHVRARRGQATDSHSLAERVRREKISEKMNMLQKLVPGCDNVTGKALVLDEIINYVQSLQNQVEVPHQYTCIFFLVSSPCSLSTTTIYVLFSIKQFMF |
ORF Type | 3prime_partial |
Blastp | Transcription factor bHLH137 from Arabidopsis with 45.96% of identity |
---|---|
Blastx | Transcription factor bHLH137 from Arabidopsis with 43.53% of identity |
Eggnog | Transcription factor(ENOG410YIH7) |
Kegg | Link to kegg annotations (AT5G50915) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463194.1) |
Pfam | Helix-loop-helix DNA-binding domain (PF00010.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer