Protein coding transcript 180748

• Transcript: Ll_transcript_197310
• CDS coordinates: 158-937 (+)
• Peptide sequence: MAAFSYQYHPFLLDPSFIPNTPIIMSSFTHTQQSHINTALHPSYEFHIPQPNQEINCVEQSSKVSICDTEPCSITKSNHSPQSSMVVDKLENGEHVTQKVSNMEKKRRNRNGSLLSGSTSKDSGEGRRKKQKKSNDEVKEEEKRKEEKKVDKEVPEQPPKGYIHVRARRGQATDSHSLAERVRREKISEKMNMLQKLVPGCDNVTGKALVLDEIINYVQSLQNQVEVPHQYTCIFFLVSSPCSLSTTTIYVLFSIKQFMF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197310

• Blastp: Transcription factor bHLH137 from Arabidopsis with 45.96% of identity
• Blastx: Transcription factor bHLH137 from Arabidopsis with 43.53% of identity
• Eggnog: Transcription factor(ENOG410YIH7)
• Kegg: Link to kegg annotations (AT5G50915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463194.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;