Protein coding transcript 180749

• Transcript: Ll_transcript_197312
• CDS coordinates: 1-960 (+)
• Peptide sequence: SEFYDRTTFGESSHCHIWLAFEYQQQKNQKPESVFAFLSSITFSIHNIFDFQKTHHTLSNQMAAFSYQYHPFLVDPAFIPNTPIIMSSLTHHKHAHINTTLPSYQSHLLQQNQEPSCVDQSYKIRISDTEPSFVTKYNLSPECSMVVDKVENGEQVNQKVTPMEKKRRIRNGSPLSISQSKDSREGKNKKQKKNNDEVKEEEKPKEEKKVEKEGPEEPPKGYIHVRARRGQATDSHSLAERVRREKISEKMNMLQKLVPGCDNVTGKALVLDEIINYVQSLQNQVEVPHQYTCIFFLVSSPCSLSTTTIYVLFSIKQFMF
• ORF Type: internal

Annotations of Ll_transcript_197312

• Blastp: Transcription factor bHLH137 from Arabidopsis with 45.41% of identity
• Blastx: Transcription factor bHLH137 from Arabidopsis with 87.69% of identity
• Eggnog: Transcription factor(ENOG410YIH7)
• Kegg: Link to kegg annotations (AT5G50915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457877.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;