Protein coding transcript 1808

• Transcript: Ll_transcript_294504
• CDS coordinates: 35-748 (+)
• Peptide sequence: MFPLQRSNNELVIQFSNLPHQQQNQFFEDLILDNYDFLNVNDSDKIFSSSQPKKLIYGAEESSHGDSIEHKKKKIVHREIERQRRQEMATLHASLRSLLPLEFIKGKRSMSEQMNGAVNYIKHMQDNIKELGAKRDELKKLSNSKLENHETNHSSRTFTIHENNGIVRIEVTIGFIEEKHTLSKLLHLLVEEGLEVVNCLSTEINGRLLHSVHCEVNKSNSVDLSELKWKVANVITS*
• ORF Type: complete

Annotations of Ll_transcript_294504

• Blastp: Transcription factor bHLH118 from Arabidopsis with 45.28% of identity
• Blastx: Transcription factor bHLH118 from Arabidopsis with 41.51% of identity
• Eggnog: Transcription factor(ENOG41114KF)
• Kegg: Link to kegg annotations (AT4G25400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449408.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;