Protein coding transcript 180823

• Transcript: Ll_transcript_196255
• CDS coordinates: 86-520 (+)
• Peptide sequence: MPSSSLLLLFFCSLATVAVSDPRATKVALLCTNRTAPMLHRDVFISSFLASMDALTPLISSQRYGAVVNGTGNNTVYAFSECFKDLSQSDCDVCLAQSKTQILTCLPFQKGTRGGRLFFDGCYLRFECFRSSFLIHLYYFFLKG*
• ORF Type: complete

Annotations of Ll_transcript_196255

• Blastp: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 52.71% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 55.36% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G70530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422197.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;