Protein coding transcript 180825

• Transcript: Ll_transcript_196277
• CDS coordinates: 260-556 (+)
• Peptide sequence: MPYEILEKASNYFNEANKLGQGGSGSVYKGVLPDGNTVAIKRLSFITTQWADHFFNEVNLINGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_196277

• Blastp: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 77.08% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 70.69% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G70530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422197.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;