Protein coding transcript 180827

• Transcript: Ll_transcript_196279
• CDS coordinates: 852-1160 (+)
• Peptide sequence: MLGHQKLAIILAAASTAAALLLVVATVVFFVKKNVLKKRREKRQFGVLLHRVSKSKLNMPYEILEKASNYFNEANKLGQGGSGSVYKVTSDLMPYYVIRQPN*
• ORF Type: complete

Annotations of Ll_transcript_196279

• Blastp: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 51.76% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 77.14% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G70530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003552033.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;