Protein coding transcript 181012

• Transcript: Ll_transcript_195430
• CDS coordinates: 3-317 (+)
• Peptide sequence: ETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKDTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_195430

• Blastp: Adenosylhomocysteinase from Nicotiana with 93.27% of identity
• Blastx: Adenosylhomocysteinase from Nicotiana with 93.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107786358)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020226164.1)
• Pfam: S-adenosyl-L-homocysteine hydrolase (PF05221.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;