Protein coding transcript 181043

• Transcript: Ll_transcript_197233
• CDS coordinates: 150-509 (+)
• Peptide sequence: MYESSKQTAVVFPQDVRHCAICKCKPGRGFEATAEVLPRLFKIKYESGTLKELLYVDMPREYHVSTGHVVLDYAKAIQESVFEKLRVVREGQLRIIFSPDLKICSWEFCARRHEDLIPNR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197233

• Blastp: Transcriptional corepressor SEUSS from Arabidopsis with 80% of identity
• Blastx: Transcriptional corepressor SEUSS from Arabidopsis with 81.51% of identity
• Eggnog: NA(ENOG410XT7C)
• Kegg: Link to kegg annotations (AT1G43850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434630.1)
• Pfam: LIM-domain binding protein (PF01803.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;