Transcript | Ll_transcript_196034 |
---|---|
CDS coordinates | 1-1377 (+) |
Peptide sequence | VKIRTLGNIRLIGELLKQKMVTERIVHHIAQELLGPPDSKVCPAEENVEAICQFFTTIGKQLDESPKSRRINDMYFSRLKELGTHPQLVPRLRFMVRDVIDLRANNWIPRREEVRAKTITEIHSEAEKNLGLRPGATTNMRNARVASSVQGNTSLGGFPISRPGTGGLMPGMPGRVMPGMPGFDNDNWEKPRTKSISRDMSGTQTAGRGQPPFLSKSSTTVNSKFLPQGSGGLSTGRNSALVHGGGGVAPSAYHSNFVVATEPAPQIPSSVKPVAAVPTEVSKAPAAKLNSDVLRKKTVSLLEEYFSVRLLGEALQCVEELKSPAYYPELVKEAISLALDRSPPCVEPVANLVEYLFIKKIISARDISNGCLLFGSMLDDIGIDLPKAPYNFGEIIGKLVLAGSLDFKGVLEILKKVEDDRFQKAIFDAAVQVITAASAQAVLDSQASDIEACRSVLN* |
ORF Type | 5prime_partial |
Blastp | Eukaryotic translation initiation factor isoform 4G-1 from Arabidopsis with 61.01% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor isoform 4G-1 from Arabidopsis with 58.46% of identity |
Eggnog | Eukaryotic translation initiation factor 4 gamma(ENOG410XS4P) |
Kegg | Link to kegg annotations (AT5G57870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463213.1) |
Pfam | MIF4G domain (PF02854.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer