Protein coding transcript 181079

• Transcript: Ll_transcript_196022
• CDS coordinates: 205-714 (+)
• Peptide sequence: MQQPDQTFISLRPGGGRSGGGGGGTRFVAPRFDSSLAAIPAFGSFSSDPSLSHAAPSIKAGDSLFEGRERVRYTRDQLLQLREATQVGEIPNDVLKIKQDLDAELFGEDQSWGRSENNMNAKTITEFHSEAEKNLGSRPGVTTNLRNTRFIPGCQGSRRRFTAAERFLS*
• ORF Type: complete

Annotations of Ll_transcript_196022

• Blastp: Eukaryotic translation initiation factor isoform 4G-1 from Arabidopsis with 42.62% of identity
• Blastx: Eukaryotic translation initiation factor isoform 4G-1 from Oryza sativa with 56.72% of identity
• Eggnog: Eukaryotic translation initiation factor 4 gamma(ENOG410XS4P)
• Kegg: Link to kegg annotations (AT5G57870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441669.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;