Transcript | Ll_transcript_197694 |
---|---|
CDS coordinates | 130-615 (+) |
Peptide sequence | MTSSSASSRKNLSKIACNRLQKELVEWQVNPPTGFNHKVTDNLQRWVIEVTGAPGTLYTNETYQLQVDFPENYPMEAPQVIFLNPAPMHPHIYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTVKQRPEDNDRYVRNCRNGRSPKETRWWFHDDKV* |
ORF Type | complete |
Blastp | Probable ubiquitin-conjugating enzyme E2 16 from Arabidopsis with 88.2% of identity |
---|---|
Blastx | Probable ubiquitin-conjugating enzyme E2 16 from Arabidopsis with 88.2% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (AT1G75440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422424.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer