Protein coding transcript 181159

• Transcript: Ll_transcript_197680
• CDS coordinates: 27-437 (+)
• Peptide sequence: MTTSSASSRKNLSKIACNRLQKELVEWQVNPPTGFNHKVTDNLQRWVIEVSGAPGTLYTNETYQLQVDFPENYPMEAPQVIFLNPAPMHPHIYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTVKQRPEDND
• ORF Type: 3prime_partial

Annotations of Ll_transcript_197680

• Blastp: Probable ubiquitin-conjugating enzyme E2 16 from Arabidopsis with 86.86% of identity
• Blastx: Probable ubiquitin-conjugating enzyme E2 16 from Arabidopsis with 86.86% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT1G75440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422424.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;