Protein coding transcript 181166

• Transcript: Ll_transcript_196946
• CDS coordinates: 704-1756 (+)
• Peptide sequence: MAQVEKREKTHQISPTSSSRSNYPRDLLQRFTTMNHNNDNHSHHNHEEEEEEEIELSLDLSMNGRFGVDPTAKKIKRTTSIPEFVNPMRIRDHAVEMDNNCSTNLIRTCSLPTENEEEWKRRKELQTLRRMEARRKRYEKQRNLKAMKERNRGGGSSEEMNGSEEGGGGGGGVDEFNSLKRTTSLTAKVGRLGLNGLPPPSPSPPPVSIGSSQGTTGSSVISESESQQGLGTKAADARSPIGGDSSPDCEQKSPPVTLRNQLNNQSSPENRTEDTVRNLLEDMPCVSTKGDGPNGKKIDGFLYRYGKGEEVRIVCVCHGSFLTPAEFIKHAGGGEVANPLKHIVVSPSML*
• ORF Type: complete

Annotations of Ll_transcript_196946

• Blastp: Ninja-family protein AFP2 from Arabidopsis with 40.94% of identity
• Blastx: Ninja-family protein AFP2 from Arabidopsis with 37.35% of identity
• Eggnog: ninja-family protein(ENOG410YWGT)
• Kegg: Link to kegg annotations (AT1G13740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429618.1)
• Pfam: Ethylene-responsive binding factor-associated repression (PF07897.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;