Protein coding transcript 181227

• Transcript: Ll_transcript_196785
• CDS coordinates: 310-645 (+)
• Peptide sequence: MALLVYFVLFMSLTGHSSANYCLCKDGVGDQALQKAIDYACGAGADCAPLMQNGPCFQPNTVKDHCNYAVNSYFQRKGQVQGSCDFSGAATPSVTGPPSKYISSKPPSNFG*
• ORF Type: complete

Annotations of Ll_transcript_196785

• Blastp: PLASMODESMATA CALLOSE-BINDING PROTEIN 3 from Arabidopsis with 57.73% of identity
• Blastx: PLASMODESMATA CALLOSE-BINDING PROTEIN 3 from Arabidopsis with 59.34% of identity
• Eggnog: X8 domain containing protein, expressed(ENOG410YNCG)
• Kegg: Link to kegg annotations (AT1G18650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462058.1)
• Pfam: X8 domain (PF07983.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;