Protein coding transcript 181296

• Transcript: Ll_transcript_196984
• CDS coordinates: 2-457 (+)
• Peptide sequence: NYILHSHSIVTTFPFLLPFLSLSSSFILSMLLRLELGQFPPELNSPALFRCVKVSPMDAPDERYAYQTAVNIGGHVFKGILYDQGPDNSYTSGTGGAGEGSSRGGGGNGGDAQQLTLTTATTTGNPFDHSQLYPPPLDAFMAGTQFFPPRS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_196984

• Blastp: Protein SHI RELATED SEQUENCE 5 from Arabidopsis with 48.85% of identity
• Blastx: Protein SHI RELATED SEQUENCE 5 from Arabidopsis with 50% of identity
• Eggnog: Domain of unknown function (DUF702)(ENOG410YDRX)
• Kegg: Link to kegg annotations (AT1G75520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432109.1)
• Pfam: Domain of unknown function (DUF702) (PF05142.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;