Transcript | Ll_transcript_294585 |
---|---|
CDS coordinates | 1-591 (+) |
Peptide sequence | ALTNDEVTKIVMQRLIKVDGKVRTDRNYPAGFMDVISIEKTDEYFRLIYDVKGRYAIHRITADEAKYKLCKVKKVCIGPKAVPYLITHDGRTIRYPDPNAKVNDTIQLDIATSKIIDIIRMDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIKDGSGHTFATRLNNVFIIGKGSKAYVSLPKGKGIKLSIAEE |
ORF Type | internal |
Blastp | 40S ribosomal protein S4 from Carabus with 85.28% of identity |
---|---|
Blastx | 40S ribosomal protein S4 from Carabus with 85.28% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464787.1) |
Pfam | S4 domain (PF01479.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer