Protein coding transcript 1813

• Transcript: Ll_transcript_294585
• CDS coordinates: 1-591 (+)
• Peptide sequence: ALTNDEVTKIVMQRLIKVDGKVRTDRNYPAGFMDVISIEKTDEYFRLIYDVKGRYAIHRITADEAKYKLCKVKKVCIGPKAVPYLITHDGRTIRYPDPNAKVNDTIQLDIATSKIIDIIRMDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIKDGSGHTFATRLNNVFIIGKGSKAYVSLPKGKGIKLSIAEE
• ORF Type: internal

Annotations of Ll_transcript_294585

• Blastp: 40S ribosomal protein S4 from Carabus with 85.28% of identity
• Blastx: 40S ribosomal protein S4 from Carabus with 85.28% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464787.1)
• Pfam: S4 domain (PF01479.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;