Protein coding transcript 181304

• Transcript: Ll_transcript_197131
• CDS coordinates: 362-964 (+)
• Peptide sequence: MKESDVNRLSLLTPPLAVKNVRKGCSSSVSRTNSNRELSSSPPTALPSLRTGSLQQQQASRKQRRCWSPELHRRFVNALQKLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRRAPSTKTDESVVVLGGLWMSQDQCNGSSKGSSSGSGSPQSPLHLATRSRGGTDSMEDEEDAKSESYSWKSHIDNKTGKVGV*
• ORF Type: complete

Annotations of Ll_transcript_197131

• Blastp: Transcription factor HHO6 from Arabidopsis with 54.6% of identity
• Blastx: Transcription factor HHO6 from Arabidopsis with 60.71% of identity
• Eggnog: MYB family transcription factor(ENOG41104MD)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422525.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;