Transcript | Ll_transcript_197134 |
---|---|
CDS coordinates | 1059-1790 (+) |
Peptide sequence | MVEDPFQPSSSRNGGGRGFLPFSSYTSIPVTTMVLPPTKEEKEDTTMNRLSLLTPPPPAVKNLREGCSSSGSRTNSNRALSSSPPMAQPSLRTGSLQQQQLASRKQRRCWSPELHRRFVNALQKLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRRVPSSNTKQPVVVLGGLWMSQDQYNDSSKGSSSVSGSPQSPLHLATGSRGGTDSMEDDEDAKSESHSWKIHIHNNTGKVGV* |
ORF Type | complete |
Blastp | Transcription factor HHO6 from Arabidopsis with 61.15% of identity |
---|---|
Blastx | Transcription factor NIGTH1 from Oryza sativa with 77.38% of identity |
Eggnog | MYB family transcription factor(ENOG41104MD) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445768.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer