Protein coding transcript 181308

• Transcript: Ll_transcript_197135
• CDS coordinates: 1059-1451 (+)
• Peptide sequence: MVEDPFQPSSSRNGGGRGFLPFSSYTSIPVTTMVLPPTKEEKEDTTMNRLSLLTPPPPAVKNLREGCSSSGSRTNSNRALSSSPPMAQPSLRTGSLQQQQLASRKQRRCWSPELHRRFVNALQKLGGSQG*
• ORF Type: complete

Annotations of Ll_transcript_197135

• Blastp: Transcription factor HHO2 from Arabidopsis with 68.42% of identity
• Blastx: Transcription factor HHO6 from Arabidopsis with 55.45% of identity
• Eggnog: Myb family transcription factor(ENOG4111TKR)
• Kegg: Link to kegg annotations (AT1G68670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445768.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;