Protein coding transcript 181311

• Transcript: Ll_transcript_197139
• CDS coordinates: 393-1253 (+)
• Peptide sequence: MGSVPAELSLDLRPTFVPKTITDFLSTLPNSSSNKLSLLNDFIARLEDEFRKIDAFKRELPLSMLLLNDAISVLKEESEKCLSRKFQPVLEEFIPLKKECDNEEENNKKDKECRDKKNWMSSVQLWNTTTTTTTNNVYDQKHHKLDNKKNEDEEQYMVEDPFQPSSSRNGGGRGFLPFSSYTSIPVTTMVLPPTKEEKEDTTMNRLSLLTPPPPAVKNLREGCSSSGSRTNSNRALSSSPPMAQPSLRTGSLQQQQLASRKQRRCWSPELHRRFVNALQKLGGSQG*
• ORF Type: complete

Annotations of Ll_transcript_197139

• Blastp: Myb family transcription factor EFM from Arabidopsis with 34.98% of identity
• Blastx: Myb family transcription factor EFM from Arabidopsis with 31.79% of identity
• Eggnog: Myb family transcription factor(ENOG410Y953)
• Kegg: Link to kegg annotations (AT2G03500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445768.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;