Transcript | Ll_transcript_237228 |
---|---|
CDS coordinates | 69-1535 (+) |
Peptide sequence | MDSLISSIFLFLFTCTVIQILRSLSNKGNHNLPPGPSLLTILVNLNEFWKKPQQTMAKLANVYGPIMCLKVGHSTSVIISSPNMAKEVLQTHDLLFSDRTIPQVVTSLNHDLLSLAFLPVSPLWRDLRKICNNELFASKTLDASQDLRRQKLQQLLNDMHQISLSGEAVDVGIAAFKTCINFLSYTFVSEDFVQNGSKDDEYKDLVATLLKLTGTPNLVDLFPVFKIFDPQGLKRRTTSYLTKFFQILDNLINKRIKLREGKHYVTNNDMLDTLLNISEQNSQMMDKKKIRHFLLDLLVAGTDTTAYALERAMTELLHNPEIMTKAKKELEQTIGIGNPIEESDIARLPYLQAIIKETLRKYPPAPLLLPRKAKVDVQICGYTVPKGARVLINEWAIGRNPSFWENANSFLPERFIGSTIDVKGQNFQLTPFGSGRRICPGSPLAIRMLHSMLGSLINTFDWKLENNMNPKDMNLDQPLRAIPIKIND* |
ORF Type | complete |
Blastp | Geraniol 8-hydroxylase from Catharanthus with 46.56% of identity |
---|---|
Blastx | Geraniol 8-hydroxylase from Catharanthus with 46.56% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAC80883) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428971.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer